Nucleoprotein, Recombinant, Zaire Ebolavirus, aa488-739, His-SUMO-Tag (NP)

Nucleoprotein, Recombinant, Zaire Ebolavirus, aa488-739, His-SUMO-Tag (NP)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
406006.20 20 µg - -

3 - 19 Werktage*

455,00 €
406006.100 100 µg - -

3 - 19 Werktage*

713,00 €
 
Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the... mehr
Produktinformationen "Nucleoprotein, Recombinant, Zaire Ebolavirus, aa488-739, His-SUMO-Tag (NP)"
Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid and serves as template for transcription and replication. During replication, encapsidation by NP is coupled to RNA synthesis and all replicative products are resistant to nucleases. Source: Recombinant protein corresponding to aa488-739 from Zaire Ebolavirus Nucleoprotein,, fused to His-SUMO-tag at N-terminal, expressed in E. coli. Molecular Weight: ~45.1kD, AA Sequence: LDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: NP, eNP, Ebola NP, Protein N, Nucleoprotein, Nucleocapsid protein
Hersteller: United States Biological
Hersteller-Nr: 406006

Eigenschaften

Konjugat: No
MW: 45,1
Format: Purified

Datenbank Information

UniProt ID : P18272 | Passende Produkte
Gene ID : GeneID 911830 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Nucleoprotein, Recombinant, Zaire Ebolavirus, aa488-739, His-SUMO-Tag (NP)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen