Nicotinamidase, Recombinant, Saccharomyces Cerevisiae, aa1-216 (PNC1)

Nicotinamidase, Recombinant, Saccharomyces Cerevisiae, aa1-216 (PNC1)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
406003.20 20 µg - -

3 - 19 Werktage*

626,00 €
406003.100 100 µg - -

3 - 19 Werktage*

932,00 €
 
Catalyzes the deamidation of nicotinamide, an early step in the NAD+ salvage pathway. Positively... mehr
Produktinformationen "Nicotinamidase, Recombinant, Saccharomyces Cerevisiae, aa1-216 (PNC1)"
Catalyzes the deamidation of nicotinamide, an early step in the NAD+ salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate. Source: Recombinant protein corresponding to aa1-216 from Saccharomyces cerevisiae Nicotinamidase, expressed in E. coli. Molecular Weight: ~25kD, AA Sequence: MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISFAKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: PNC1, NAMase, YGL037C, Nicotinamidase, Nicotinamide deamidase
Hersteller: United States Biological
Hersteller-Nr: 406003

Eigenschaften

Konjugat: No
MW: 25
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Nicotinamidase, Recombinant, Saccharomyces Cerevisiae, aa1-216 (PNC1)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen