NGB, Recombinant, Human, aa1-151, His-SUMO-Tag (Neuroglobin)

NGB, Recombinant, Human, aa1-151, His-SUMO-Tag (Neuroglobin)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374414.10 10 µg - -

1 - 19 Werktage

354,00 €
374414.50 50 µg - -

1 - 19 Werktage

472,00 €
374414.100 100 µg - -

1 - 19 Werktage

658,00 €
374414.200 200 µg - -

1 - 19 Werktage

906,00 €
 
Involved in oxygen transport in the brain. Hexacoordinate globin, displaying competitive binding... mehr
Produktinformationen "NGB, Recombinant, Human, aa1-151, His-SUMO-Tag (Neuroglobin)"
Involved in oxygen transport in the brain. Hexacoordinate globin, displaying competitive binding of oxygen or the distal His residue to the iron atom. Not capable of penetrating cell membranes. The deoxygenated form exhibits nitrite reductase activity inhibiting cellular respiration via NO-binding to cytochrome c oxidase. Involved in neuroprotection during oxidative stress. May exert its anti-apoptotic activity by acting to reset the trigger level of mitochondrial cytochrome c release necessary to commit the cells to apoptosis. Source: Recombinant protein corresponding to aa1-151 from human NGB, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.9kD, AA Sequence: MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: NGB, Neuroglobin
Hersteller: United States Biological
Hersteller-Nr: 374414

Eigenschaften

Konjugat: No
MW: 32,9
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "NGB, Recombinant, Human, aa1-151, His-SUMO-Tag (Neuroglobin)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Hier folgen Informationen zur Produktreferenz. mehr
Neuroglobin, human recombinant (rHuNeuroglobin) Neuroglobin, human recombinant (rHuNeuroglobin)
Bitte fragen Sie den aktuellen Preis für diesen Artikel an.
Zuletzt angesehen