NDUFB10, Recombinant, Human, aa1-172, GST-Tag (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Sub

NDUFB10, Recombinant, Human, aa1-172, GST-Tag (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Sub
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374391.20 20 µg - -

3 - 19 Werktage*

511,00 €
374391.100 100 µg - -

3 - 19 Werktage*

773,00 €
 
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I),... mehr
Produktinformationen "NDUFB10, Recombinant, Human, aa1-172, GST-Tag (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Sub"
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Source: Recombinant protein corresponding to aa1-172 from human NDUFB10, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.8kD, AA Sequence: MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: CI-PDSW, NDUFB10, Complex I-PDSW, NADH-ubiquinone oxidoreductase PDSW subunit, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
Hersteller: United States Biological
Hersteller-Nr: 374391

Eigenschaften

Konjugat: No
MW: 47,8
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "NDUFB10, Recombinant, Human, aa1-172, GST-Tag (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Sub"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen