Myoglobin, Recombinant, Mouse aa2-154, His-tag, Myc-tag (Mb)

Myoglobin, Recombinant, Mouse aa2-154, His-tag, Myc-tag (Mb)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405997.20 20 µg - -

3 - 19 Werktage*

455,00 €
405997.100 100 µg - -

3 - 19 Werktage*

713,00 €
 
Serves as a reserve supply of oxygen and facilitates the movement of oxygen within... mehr
Produktinformationen "Myoglobin, Recombinant, Mouse aa2-154, His-tag, Myc-tag (Mb)"
Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles. Source: Recombinant protein corresponding to aa2-154 from mouse Myoglobin, fused to His-tag at N-terminal and fused to Myc-tag at C-terminal, expressed in E. coli. Molecular Weight: ~21.9kD, A Sequence: GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Mb, Myoglobin
Hersteller: United States Biological
Hersteller-Nr: 405997

Eigenschaften

Konjugat: No
MW: 21,9
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Myoglobin, Recombinant, Mouse aa2-154, His-tag, Myc-tag (Mb)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen