MRPL20, Recombinant, Human, aa46-149, His-SUMO-Tag (39S Ribosomal Protein L20, Mitochondrial)

Source:, Recombinant protein corresponding to aa46-149 from human MRPL20, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.8kD, AA Sequence: VIRAFVKCTKARYLKKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.