Lymphocyte Antigen 6G, Recombinant, Mouse, aa4-96, His-SUMOSTAR-tag (Ly6g)

Source:, Recombinant protein corresponding to aa4-96 from mouse lymphocyte antigen 6G, fused to His-SUMOSTAR-tag at N-terminal, expressed in yeast. Molecular Weight: ~25.9kD, AA Sequence: LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.