Lymphocyte Antigen 6G, Recombinant, Mouse, aa4-96, His-SUMOSTAR-tag (Ly6g)

Lymphocyte Antigen 6G, Recombinant, Mouse, aa4-96, His-SUMOSTAR-tag (Ly6g)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405980.20 20 µg - -

3 - 19 Werktage*

497,00 €
405980.100 100 µg - -

3 - 19 Werktage*

827,00 €
 
Source:|Recombinant protein corresponding to aa4-96 from mouse lymphocyte antigen 6G, fused to... mehr
Produktinformationen "Lymphocyte Antigen 6G, Recombinant, Mouse, aa4-96, His-SUMOSTAR-tag (Ly6g)"
Source:, Recombinant protein corresponding to aa4-96 from mouse lymphocyte antigen 6G, fused to His-SUMOSTAR-tag at N-terminal, expressed in yeast. Molecular Weight: ~25.9kD, AA Sequence: LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Ly6g, Ly-6G, Ly-6G.1, Lymphocyte antigen 6G
Hersteller: United States Biological
Hersteller-Nr: 405980

Eigenschaften

Konjugat: No
MW: 25,9
Format: Purified

Datenbank Information

UniProt ID : P35461 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Lymphocyte Antigen 6G, Recombinant, Mouse, aa4-96, His-SUMOSTAR-tag (Ly6g)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen