Limulus Clotting Factor C, Recombinant, Tachypleus Tridentatus, aa763-1019, His-tag, Myc-tag

Limulus Clotting Factor C, Recombinant, Tachypleus Tridentatus, aa763-1019, His-tag, Myc-tag
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405977.20 20 µg - -

3 - 19 Werktage*

511,00 €
405977.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
This enzyme is closely associated with an endotoxin-sensitive hemolymph coagulation system which... mehr
Produktinformationen "Limulus Clotting Factor C, Recombinant, Tachypleus Tridentatus, aa763-1019, His-tag, Myc-tag"
This enzyme is closely associated with an endotoxin-sensitive hemolymph coagulation system which may play important roles in both hemostasis and host defense mechanisms. Its active form catalyzes the activation of factor B. Source: Recombinant protein corresponding to aa763-1019 from Tachypleus tridentatus Limulus Clotting Factor C, fused to His-tag at N-terminal and Myc-tag at C-terminal, expressed in E. coli. Molecular Weight: ~33.8kD, AA Sequence: IWNGNSTEIGQWPWQAGISRWLADHNMWFLQCGGSLLNEKWIVTAAHCVTYSATAEIIDPSQFKIYLGKYYRDDSRDDDYVQVREALEIHVNPNYDPGNLNFDIALIQLKTPVTLTTRVQPICLPTDITTREHLKEGTLAVVTGWGLNENNTYSEMIQQAVLPVVAASTCEEGYKEADLPLTVTENMFCAGYKKGRYDACSGDSGGPLVFADDSRTERRWVLEGIVSWGSPSGCGKANQYGGFTKVNVFLSWIRQFI, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: EC=3.4.21.84
Hersteller: United States Biological
Hersteller-Nr: 405977

Eigenschaften

Konjugat: No
MW: 33,8
Format: Purified

Datenbank Information

KEGG ID : K22079 | Passende Produkte
UniProt ID : P28175 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Limulus Clotting Factor C, Recombinant, Tachypleus Tridentatus, aa763-1019, His-tag, Myc-tag"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen