Lgals7, Recombinant, Mouse, aa2-136, His-Tag (Galectin-7)

Lgals7, Recombinant, Mouse, aa2-136, His-Tag (Galectin-7)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374023.10 10 µg - -

3 - 19 Werktage*

406,00 €
374023.50 50 µg - -

3 - 19 Werktage*

543,00 €
374023.100 100 µg - -

3 - 19 Werktage*

780,00 €
374023.200 200 µg - -

3 - 19 Werktage*

1.107,00 €
 
Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth... mehr
Produktinformationen "Lgals7, Recombinant, Mouse, aa2-136, His-Tag (Galectin-7)"
Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release. Source: Recombinant protein corresponding to aa2-136 from mouse Galectin-7, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17kD, AA Sequence: SATHHKTSLPQGVRVGTVMRIRGLVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKQQGKWGREERGTGIPFQRGQPFEVLLIATEEGFKAVVGDDEYLHFHHRLPPARVRLVEVGGDVQLHSLNIF, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Gal-7, Lgals7, Galectin-7
Hersteller: United States Biological
Hersteller-Nr: 374023

Eigenschaften

Konjugat: No
MW: 17
Format: Purified

Datenbank Information

UniProt ID : O54974 | Finde Alternativen

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Lgals7, Recombinant, Mouse, aa2-136, His-Tag (Galectin-7)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen