Lgals4, Recombinant, Mouse, aa1-326, His-Tag (Galectin-4)

Lgals4, Recombinant, Mouse, aa1-326, His-Tag (Galectin-4)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374019.10 10 µg - -

3 - 19 Werktage*

438,00 €
374019.50 50 µg - -

3 - 19 Werktage*

591,00 €
374019.100 100 µg - -

3 - 19 Werktage*

862,00 €
374019.200 200 µg - -

3 - 19 Werktage*

1.242,00 €
 
Galectin that binds lactose and a related range of sugars.||Source:|Recombinant protein... mehr
Produktinformationen "Lgals4, Recombinant, Mouse, aa1-326, His-Tag (Galectin-4)"
Galectin that binds lactose and a related range of sugars. Source: Recombinant protein corresponding to aa1-326 from mouse Lgals4, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~38.4kD, AA Sequence: MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Gal-4, Lgals4, Galectin-4, Lactose-binding lectin 4
Hersteller: United States Biological
Hersteller-Nr: 374019

Eigenschaften

Konjugat: No
MW: 38,4
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Lgals4, Recombinant, Mouse, aa1-326, His-Tag (Galectin-4)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Galectin-4, His tag, mouse recombinant (rmLGALS4-His) Galectin-4, His tag, mouse recombinant (rmLGALS4-His)
Bitte fragen Sie den aktuellen Preis für diesen Artikel an.
Zuletzt angesehen