L-lactate Dehydrogenase, Recombinant, Plasmodium Berghei, aa1-316, His-SUMO-Tag, Myc-Tag

L-lactate Dehydrogenase, Recombinant, Plasmodium Berghei, aa1-316, His-SUMO-Tag, Myc-Tag
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405973.20 20 µg - -

3 - 19 Werktage*

511,00 €
405973.100 100 µg - -

3 - 19 Werktage*

818,00 €
Source:|Recombinant protein corresponding to aa1-316 from Plasmodium berghei L-lactate... mehr
Produktinformationen "L-lactate Dehydrogenase, Recombinant, Plasmodium Berghei, aa1-316, His-SUMO-Tag, Myc-Tag"
Source:, Recombinant protein corresponding to aa1-316 from Plasmodium berghei L-lactate dehydrogenase, fused to His-SUMO-Tag at N-terminal and fused to Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~39.4kD, AA sequence: MAPKAKIVLVGSGMIGGVMATLIVQKNLGDVVMFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLKDADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIVGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDQELDAIFDRTINTALEIVNLHASPYVAPAAAIIEMAESYIRDLRKVLICSTLLEGQYGHKDIFAGTPLVIGGNGVEQVIELQLNADEKKKFDEAVAETSRMKALI, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: EC=, L-lactate dehydrogenase
Hersteller: United States Biological
Hersteller-Nr: 405973


Konjugat: No
MW: 39,4
Format: Purified

Datenbank Information

UniProt ID : Q7SI97 | Passende Produkte
Gene ID : GeneID 3428010 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "L-lactate Dehydrogenase, Recombinant, Plasmodium Berghei, aa1-316, His-SUMO-Tag, Myc-Tag"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen