L-lactate Dehydrogenase A Chain, Recombinant, Human, aa5-323 (LDHA)

L-lactate Dehydrogenase A Chain, Recombinant, Human, aa5-323 (LDHA)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405972.20 20 µg - -

3 - 19 Werktage*

560,00 €
405972.100 100 µg - -

3 - 19 Werktage*

785,00 €
 
Cell proliferation-inducing gene 19 protein LDH muscle subunit.||Source:|Recombinant protein... mehr
Produktinformationen "L-lactate Dehydrogenase A Chain, Recombinant, Human, aa5-323 (LDHA)"
Cell proliferation-inducing gene 19 protein LDH muscle subunit. Source: Recombinant protein corresponding to aa5-323 from human L-lactate dehydrogenase A chain, expressed in E. coli. Molecular Weight: ~35.1kD, AA Sequence: KDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: LDHA, PIG19, LDH-M, LDH-A, EC=1.1.1.27, LDH muscle subunit, L-lactate dehydrogenase A chain, Renal carcinoma antigen NY-REN-59, Cell proliferation-inducing gene 19 protein
Hersteller: United States Biological
Hersteller-Nr: 405972

Eigenschaften

Konjugat: No
MW: 35,1
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "L-lactate Dehydrogenase A Chain, Recombinant, Human, aa5-323 (LDHA)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen