K99 Fimbrial Protein, Recombinant, E. coli, aa23-181 (fanC)

K99 Fimbrial Protein, Recombinant, E. coli, aa23-181 (fanC)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405969.20 20 µg - -

3 - 19 Werktage*

626,00 €
405969.100 100 µg - -

3 - 19 Werktage*

932,00 €
 
Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a... mehr
Produktinformationen "K99 Fimbrial Protein, Recombinant, E. coli, aa23-181 (fanC)"
Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs. FanC is the main component of the K99 fimbriae. Source: Recombinant protein corresponding to aa23-181 from E. coli K99 fimbrial protein, expressed in E. coli. Molecular Weight: ~16.5kD, AA Sequence: NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: fanC, K99 fimbrial protein
Hersteller: United States Biological
Hersteller-Nr: 405969

Eigenschaften

Konjugat: No
MW: 16,5
Format: Purified

Datenbank Information

UniProt ID : P18103 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "K99 Fimbrial Protein, Recombinant, E. coli, aa23-181 (fanC)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen