Hepatitis Small Delta Antigen, Recombinant, Delta Virus Genotype I, aa1-195, His-tag, Myc-tag

Hepatitis Small Delta Antigen, Recombinant, Delta Virus Genotype I, aa1-195, His-tag, Myc-tag
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405940.20 20 µg - -

3 - 19 Werktage*

497,00 €
405940.100 100 µg - -

3 - 19 Werktage*

827,00 €
 
Promotes both transcription and replication of genomic RNA. Following virus entry into host cell,... mehr
Produktinformationen "Hepatitis Small Delta Antigen, Recombinant, Delta Virus Genotype I, aa1-195, His-tag, Myc-tag"
Promotes both transcription and replication of genomic RNA. Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. May interact with host RNA polymerase II thereby changing its template requirement from DNA to RNA. RNA pol II complex would then acts as an RNA-directed RNA polymerase, and transcribe and replicate HDV genome. Source: Recombinant protein corresponding to aa1-195 from Hepatitis Delta Virus Genotype I Small Delta Antigen, fused to His-tag at N-terminal and fused to Myc-tag at C-terminal, expressed in Yeast. Molecular Weight: ~25.4kD, AA Sequence: MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: p24, S-HDAg, Small delta antigen
Hersteller: United States Biological
Hersteller-Nr: 405940

Eigenschaften

Konjugat: No
MW: 25,4
Format: Purified

Datenbank Information

UniProt ID : P06934 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Hepatitis Small Delta Antigen, Recombinant, Delta Virus Genotype I, aa1-195, His-tag, Myc-tag"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen