Growth Hormone Receptor, Recombinant, Porcine, aa19-264, His-Tag (GHR)

Growth Hormone Receptor, Recombinant, Porcine, aa19-264, His-Tag (GHR)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517942.20 20 µg - -

3 - 19 Werktage*

455,00 €
517942.200 200 µg - -

3 - 19 Werktage*

1.007,00 €
 
Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On... mehr
Produktinformationen "Growth Hormone Receptor, Recombinant, Porcine, aa19-264, His-Tag (GHR)"
Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to, and activates the JAK2/STAT5 pathway. The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling. Source: Partial recombinant protein corresponding to aa19-264 of porcine Growth Hormone Receptor, fused to 6xHis-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~30.3kD, AA Sequence: FSGSEATPAVLVRASQSLQRVHPGLETNSSGKPKFTKCRSPELETFSCHWTDGVRHGLQSPGSIQLFYIRRSTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTSNGGTVDQKCFSVEEIVQPDPPIGLNWTLLNISLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRNSEKYGEFSEVLYVTLPQMSPFACEEDFR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: GHR
Hersteller: United States Biological
Hersteller-Nr: 517942

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Swine
MW: 30.3 kD
Reinheit: ?85% (SDS-PAGE)

Datenbank Information

UniProt ID : P19756 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Growth Hormone Receptor, Recombinant, Porcine, aa19-264, His-Tag (GHR)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen