GMFG, Recombinant, Human (GMF-gamma, Glia Maturation Factor, gamma)

GMFG, Recombinant, Human (GMF-gamma, Glia Maturation Factor, gamma)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
G2035-66A.10 10 µg - -

3 - 19 Werktage*

489,00 €
 
GMFG is a hematopoietic-specific protein that mediates the pluripotentiality and lineage... mehr
Produktinformationen "GMFG, Recombinant, Human (GMF-gamma, Glia Maturation Factor, gamma)"
GMFG is a hematopoietic-specific protein that mediates the pluripotentiality and lineage commitment of human hematopoietic stem cells. Glia maturation factor gamma is a cytokine-responsive protein in EPO-induced and G-CSF-induced hematopoietic lineage development. Glia maturation factor also acts as a Nerve Growth Factor in nervous system development, angiogenesis and immune function. GMFG possesses hematopoietic tissue-specific gene expression, a promoter concentrated with high-score hematopoiesis-specific transcription factors, and molecular coevolution with a rudimentary blood/immune system. Glia Maturation Factor-Gamma (GMF-Gamma) Human Recombinant produced in E. coli is a single, non-glycosylated, polypeptide chain containing 142aa and having a total molecular mass of 16.8kD. Glia Maturation Factor-Gamma, GMF-Gamma, Human Recombinant is purified by proprietary chromatographic techniques. Source: Recombinant corresponding to human GMF-Gamma expressed in E. coli. AA Sequence: MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQP-RFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR , Molecular Weight: , ~16.8kD, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: GMFG, GMF-gamma, Glia maturation factor gamma
Hersteller: United States Biological
Hersteller-Nr: G2035-66A

Eigenschaften

Konjugat: No
Ursprungsart: Human
Format: Purified

Datenbank Information

UniProt ID : O60234 | Finde Alternativen
Gene ID GeneID 9535 | Finde Alternativen

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "GMFG, Recombinant, Human (GMF-gamma, Glia Maturation Factor, gamma)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen