Glutaminyl-Peptide Cyclotransferase, Recombinant, Mouse, aa36-362, His-Tag (Qpct)

Glutaminyl-Peptide Cyclotransferase, Recombinant, Mouse, aa36-362, His-Tag (Qpct)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517934.20 20 µg - -

3 - 19 Werktage*

537,00 €
517934.100 100 µg - -

3 - 19 Werktage*

834,00 €
 
Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and... mehr
Produktinformationen "Glutaminyl-Peptide Cyclotransferase, Recombinant, Mouse, aa36-362, His-Tag (Qpct)"
Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. Source: Recombinant protein corresponding to aa36-362 of mouse Glutaminyl-Peptide Cyclotransferase, fused to 6xHis-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~39.6kD, AA Sequence: AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: QC, Qpct, EC=2.3.2.5, Glutaminyl cyclase, Glutaminyl-tRNA cyclotransferase, Glutaminyl-peptide cyclotransferase
Hersteller: United States Biological
Hersteller-Nr: 517934

Eigenschaften

Konjugat: No
Spezies-Reaktivität: mouse
MW: 39.6 kD
Reinheit: ?90% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Glutaminyl-Peptide Cyclotransferase, Recombinant, Mouse, aa36-362, His-Tag (Qpct)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen