Glucocorticoid Receptor, Recombinant, Human, aa521-777, His-Trx-Tag (NR3C1, Nuclear Receptor Subfami

Glucocorticoid Receptor, Recombinant, Human, aa521-777, His-Trx-Tag (NR3C1, Nuclear Receptor Subfami
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517927.20 20 µg - -

3 - 19 Werktage*

455,00 €
517927.200 200 µg - -

3 - 19 Werktage*

1.007,00 €
 
Receptor for glucocorticoids (GC). Has a dual mode of action: as a transcription factor that... mehr
Produktinformationen "Glucocorticoid Receptor, Recombinant, Human, aa521-777, His-Trx-Tag (NR3C1, Nuclear Receptor Subfami"
Receptor for glucocorticoids (GC). Has a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE), both for nuclear and mitochondrial DNA, and as a modulator of other transcription factors. Affects inflammatory responses, cellular proliferation and differentiation in target tissues. Involved in chromatin remodeling. Plays a role in rapid mRNA degradation by binding to the 5' UTR of target mRNAs and interacting with PNRC2 in a ligand-dependent manner which recruits the RNA helicase UPF1 and the mRNA-decapping enzyme DCP1A, leading to RNA decay. Could act as a coactivator for STAT5-dependent transcription upon growth hormone (GH) stimulation and could reveal an essential role of hepatic GR in the control of body growth. Source: Partial recombinant protein corresponding to aa521-777 of human Glucocorticoid Receptor, fused to 6xHis-Trx-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.8kD, AA Sequence: VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: GR, GRL, NR3C1, Glucocorticoid receptor, Nuclear receptor subfamily 3 group C member 1
Hersteller: United States Biological
Hersteller-Nr: 517927

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Human
MW: 47.8 kD
Reinheit: ?85% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Glucocorticoid Receptor, Recombinant, Human, aa521-777, His-Trx-Tag (NR3C1, Nuclear Receptor Subfami"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen