Gelatinase, Recombinant, Enterococcus Faecalis, aa193-510, His-Sumo-Tag (gelE)

Gelatinase, Recombinant, Enterococcus Faecalis, aa193-510, His-Sumo-Tag (gelE)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517922.20 20 µg - -

3 - 19 Werktage*

511,00 €
517922.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Metalloprotease capable of the hydrolysis of insoluble hydrophobic substrates. Hydrolyzes azocoll... mehr
Produktinformationen "Gelatinase, Recombinant, Enterococcus Faecalis, aa193-510, His-Sumo-Tag (gelE)"
Metalloprotease capable of the hydrolysis of insoluble hydrophobic substrates. Hydrolyzes azocoll and gelatin and, at a lower rate, soluble and insoluble collagens. Does not cleave short synthetic peptides. Preferentially hydrolyzes the 24-Phe-, -Phe-25 bond in the insulin B-chain, followed by the 5-His-, -Leu-6 bond. Inactivates endothelin-1, primarily by cleavage of the 5-Ser-, -Leu-6 and 16-His-, -Leu-17 bonds. Hydrolyzes the alpha chain of C3 to generate a C3b-like protein. Inhibits complement-mediated hemolysis and opsinization of bacteria. Hydrolyzes the insect antimicrobial peptide cecropin. Decreases the length of E.faecalis chains via the activation of autolysin. Degrades polymerized fibrin. Source: Recombinant protein corresponding to aa193-510 of Enterococcus Faecalis Gelatinase, fused to 6xHis-Sumo-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~50.5kD, AA Sequence: VGSEVTLKNSFQVAFNVPVEKSNTGIALHGTDNTGVYHAVVDGKNNYSIIQAPSLVALNQNAVDAYTHGKFVKTYYEDHFQRHSIDDRGMPILSVVDEQHPDAYDNAFWDGKAMRYGETSTPTGKTYASSLDVVGHEMTHGVTEHTAGLEYLGQSGALNESYSDLMGYIISGASNPEIGADTQSVDRKTGIRNLQTPSKHGQPETMAQYDDRARYKGTPYYDQGGVHYNSGIINRIGYTIIQNLGIEKAQTIFYSSLVNYLTPKAQFSDARDAMLAAAKVQYGDEAASVVSAAFNSAGIGAKEDIQVNQPSESVLVNE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: EF_1818, Coccolysin, Gelatinase, EC=3.4.24.30
Hersteller: United States Biological
Hersteller-Nr: 517922

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Enterococcus Faecalis
MW: 50.5 kD
Reinheit: ?90% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Gelatinase, Recombinant, Enterococcus Faecalis, aa193-510, His-Sumo-Tag (gelE)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen