GDNF Family Receptor Alpha-Like, Recombinant, Human, aa19-351, His-Sumo-Tag (GFRAL)

GDNF Family Receptor Alpha-Like, Recombinant, Human, aa19-351, His-Sumo-Tag (GFRAL)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517920.20 20 µg - -

3 - 19 Werktage*

455,00 €
517920.100 100 µg - -

3 - 19 Werktage*

713,00 €
 
Source:|Recombinant protein corresponding to aa19-351 of human GDNF Family Receptor Alpha-Like,... mehr
Produktinformationen "GDNF Family Receptor Alpha-Like, Recombinant, Human, aa19-351, His-Sumo-Tag (GFRAL)"
Source:, Recombinant protein corresponding to aa19-351 of human GDNF Family Receptor Alpha-Like, fused to 6xHis-Sumo-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~53.8kD, AA Sequence: SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: C6orf144, GDNF family receptor alpha-like
Hersteller: United States Biological
Hersteller-Nr: 517920

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Human
MW: 53.8 kD
Reinheit: ?85% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "GDNF Family Receptor Alpha-Like, Recombinant, Human, aa19-351, His-Sumo-Tag (GFRAL)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen