Gamma-Synuclein, Recombinant, Macaca Fascicularis, aa1-127 (SNCG)

Gamma-Synuclein, Recombinant, Macaca Fascicularis, aa1-127 (SNCG)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517919.20 20 µg - -

3 - 19 Werktage*

570,00 €
517919.100 100 µg - -

3 - 19 Werktage*

832,00 €
 
Plays a role in neurofilament network integrity. May be involved in modulating axonal... mehr
Produktinformationen "Gamma-Synuclein, Recombinant, Macaca Fascicularis, aa1-127 (SNCG)"
Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases (By similarity). May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway. Source: Recombinant full length protein corresponding to aa1-127 of human Macaca Fascicularis, expressed in E. coli. Molecular Weight: ~13.3kD, AA Sequence: MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVHSVTSVAEKTKEQANAVSEAVVSSVNTVAAKTVEEAENIAVTSGVVRKEDLKPSAPQQEGEAAKEKEEVAEEAQSGGD, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: SNCG, QflA-20719, Gamma-synuclein
Hersteller: United States Biological
Hersteller-Nr: 517919

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Macaca Fascicularis
MW: 13.3 kD
Reinheit: ?85% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Gamma-Synuclein, Recombinant, Macaca Fascicularis, aa1-127 (SNCG)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen