Gamma-Crystallin B, Recombinant, Rat, aa2-175, His-Tag (Crygb)

Gamma-Crystallin B, Recombinant, Rat, aa2-175, His-Tag (Crygb)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517918.20 20 µg - -

3 - 19 Werktage*

455,00 €
517918.100 100 µg - -

3 - 19 Werktage*

711,00 €
 
Crystallins are the dominant structural components of the vertebra.||Source:|Recombinant protein... mehr
Produktinformationen "Gamma-Crystallin B, Recombinant, Rat, aa2-175, His-Tag (Crygb)"
Crystallins are the dominant structural components of the vertebra. Source: Recombinant protein corresponding to aa2-175 of rat Gamma-Crystallin B, fused to 6xHis-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~23kD, AA Sequence: GKITFFEDRGFQGRCYECSSDCPNLQTYFSRCNSVRVDSGCWMLYERPNYQGHQYFLRRGDYPDYQQWMGFSDSIRSCRLIPQHSGTYRMRIYERDDFRGQMSEITDDCLSLQDRFHLSEIHSLNVMEGCWVLYEMPSYRGRQYLLRPGEYRRYLDWGAANAKVGSFRRVMDFY, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Crygb, Gamma-B-crystallin, Gamma-crystallin B, Gamma-crystallin 1-2
Hersteller: United States Biological
Hersteller-Nr: 517918

Eigenschaften

Konjugat: No
Ursprungsart: Rat
MW: 23 kD
Reinheit: ?85% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Gamma-Crystallin B, Recombinant, Rat, aa2-175, His-Tag (Crygb)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen