Frataxin, Mitochondrial, Recombinant, Rat, aa41-208 (Fxn)

Frataxin, Mitochondrial, Recombinant, Rat, aa41-208 (Fxn)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405926.20 20 µg - -

3 - 19 Werktage*

570,00 €
405926.100 100 µg - -

3 - 19 Werktage*

832,00 €
Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering... mehr
Produktinformationen "Frataxin, Mitochondrial, Recombinant, Rat, aa41-208 (Fxn)"
Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+, the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1. Source: Recombinant protein corresponding to aa41-208 from rat Frataxin, expressed in E. coli. Molecular Weight: ~18.6kD, AA Sequence: LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Fxn, EC=
Hersteller: United States Biological
Hersteller-Nr: 405926


Konjugat: No
MW: 18,6
Format: Purified

Datenbank Information

UniProt ID : D3ZYW7 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Frataxin, Mitochondrial, Recombinant, Rat, aa41-208 (Fxn)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen