fMet-Leu-Phe Receptor, Recombinant, Mouse, aa1-35, His-GST-Tag, Myc-Tag (FPR1)

fMet-Leu-Phe Receptor, Recombinant, Mouse, aa1-35, His-GST-Tag, Myc-Tag (FPR1)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517912.20 20 µg - -

3 - 19 Werktage*

511,00 €
517912.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil... mehr
Produktinformationen "fMet-Leu-Phe Receptor, Recombinant, Mouse, aa1-35, His-GST-Tag, Myc-Tag (FPR1)"
High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Source: Recombinant protein corresponding to aa1-35 of mouse fMet-Leu-Phe Receptor, fused to 10xHis-GST-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~33.7kD, AA Sequence: MDTNMSLLMNKSAVNLMNVSGSTQSVSAGYIVLDV, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: FPR, Fpr1, fMLP receptor, fMet-Leu-Phe receptor, N-formyl peptide receptor, N-formylpeptide chemoattractant receptor
Hersteller: United States Biological
Hersteller-Nr: 517912

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Mouse
MW: 33.7 kD
Reinheit: ?85% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "fMet-Leu-Phe Receptor, Recombinant, Mouse, aa1-35, His-GST-Tag, Myc-Tag (FPR1)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen