FKBP-Type Peptidyl-Prolyl Cis-Trans Isomerase fkpA, Recombinant, E. coli, aa26-270, His-Tag, Myc-Tag

FKBP-Type Peptidyl-Prolyl Cis-Trans Isomerase fkpA, Recombinant, E. coli, aa26-270, His-Tag, Myc-Tag
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517902.20 20 µg - -

3 - 19 Werktage*

511,00 €
517902.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline... mehr
Produktinformationen "FKBP-Type Peptidyl-Prolyl Cis-Trans Isomerase fkpA, Recombinant, E. coli, aa26-270, His-Tag, Myc-Tag"
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Source: Recombinant protein corresponding to aa26-270 of E. coli FKBP-Type Peptidyl-Prolyl Cis-Trans Isomerase fkpA, fused to 10xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~33.2kD, AA Sequence: AEAAKPATAADSKAAFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVKPAPKADAKPEADAKAADSAKK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: yzzS, fkpA, b3347, PPIase, Rotamase, EC=5.2.1.8, FKBP-type peptidyl-prolyl cis-trans isomerase FkpA
Hersteller: United States Biological
Hersteller-Nr: 517902

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: E.coli
MW: 33.2 kD
Reinheit: ?85% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "FKBP-Type Peptidyl-Prolyl Cis-Trans Isomerase fkpA, Recombinant, E. coli, aa26-270, His-Tag, Myc-Tag"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen