FKBP-Type Peptidyl-Prolyl Cis-Trans Isomerase FkpA, Recombinant, Aeromonas Hydrophila, aa21-268, His

FKBP-Type Peptidyl-Prolyl Cis-Trans Isomerase FkpA, Recombinant, Aeromonas Hydrophila, aa21-268, His
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517901.20 20 µg - -

3 - 19 Werktage*

636,00 €
517901.100 100 µg - -

3 - 19 Werktage*

985,00 €
 
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline... mehr
Produktinformationen "FKBP-Type Peptidyl-Prolyl Cis-Trans Isomerase FkpA, Recombinant, Aeromonas Hydrophila, aa21-268, His"
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. FkpA probably acts in the folding of extra cytoplasmic domain proteins. Source: Recombinant protein corresponding to aa21-268 of Aeromonas Hydrophila FKBP-Type Peptidyl-Prolyl Cis-Trans Isomerase FkpA, fused to 6xHis-Sumo-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.7kD, AA Sequence: CQKDEKTAANTAEVKAEASKPAEAPKAEAKSFEEQSGYAIGLSMGRYIANTLERQQELGIKLDNSVILKGVTDGLGKEAKMTDEEIQKVLQQYDAKINELTKAKADKDAVENQKKGEEYLAANAKKEGVKSTESGLQYQVEKMGTGAKPKATDIVKVHYTGTLTDGTKFDSSVDRGEPATFPLNQVIPGWTEGVQLMPVGSKFKFFLPSKLAYGEHGAGSIPANAVLVFDVELLAIEKPAADGDNAKK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: fkpA, PPIase, Rotamase, EC=5.2.1.8, FKBP-type peptidyl-prolyl cis-trans isomerase FkpA
Hersteller: United States Biological
Hersteller-Nr: 517901

Eigenschaften

Konjugat: No
Wirt: E.coli
Spezies-Reaktivität: Aeromonas hydrophila
MW: 42.7 kD
Reinheit: ?90% (SDS-PAGE)

Datenbank Information

UniProt ID : O08437 | Passende Produkte
Gene ID GeneID 4487181 | Passende Produkte

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "FKBP-Type Peptidyl-Prolyl Cis-Trans Isomerase FkpA, Recombinant, Aeromonas Hydrophila, aa21-268, His"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen