Envelope Glycoprotein B, Recombinant, Rhesus Cytomegalovirus, aa745-854, His-tag, Myc-tag (gB)

Envelope Glycoprotein B, Recombinant, Rhesus Cytomegalovirus, aa745-854, His-tag, Myc-tag (gB)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405919.20 20 µg - -

3 - 19 Werktage*

455,00 €
405919.100 100 µg - -

3 - 19 Werktage*

713,00 €
 
Envelope glycoprotein that forms spikes at the surface of virion envelope. Essential for the... mehr
Produktinformationen "Envelope Glycoprotein B, Recombinant, Rhesus Cytomegalovirus, aa745-854, His-tag, Myc-tag (gB)"
Envelope glycoprotein that forms spikes at the surface of virion envelope. Essential for the initial attachment to heparan sulfate moities of the host cell surface proteoglycans. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding to its host receptors, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May be involved in the fusion between the virion envelope and the outer nuclear membrane during virion egress. Source: Recombinant protein corresponding to aa745-854 from rhesus cytomegalovirus Envelope Glycoprotein B, fused to His-tag at N-terminal and Myc-tag at C-terminal, expressed in E. coli. Molecular Weight: ~18.0kD, AA Sequence: MRQKRAYEKPFEHFFPYVVPPTTVKEAPPSYEQSQYENIKEKAASATKEFSLEEAYQMLLALQKLDQEKRRKAEADDEDFASNGQSAGFLDRLRNRRRGGYQKIQNEYEV, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: gB, UL55, Envelope glycoprotein B
Hersteller: United States Biological
Hersteller-Nr: 405919

Eigenschaften

Konjugat: No
MW: 18
Format: Purified

Datenbank Information

UniProt ID : P89053 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Envelope Glycoprotein B, Recombinant, Rhesus Cytomegalovirus, aa745-854, His-tag, Myc-tag (gB)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen