Enterotoxin Type C-2, Recombinant, Staphylococcus aureus, aa28-266 (EntC2)

Enterotoxin Type C-2, Recombinant, Staphylococcus aureus, aa28-266 (EntC2)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405917.20 20 µg - -

3 - 19 Werktage*

626,00 €
405917.100 100 µg - -

3 - 19 Werktage*

932,00 €
 
Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The... mehr
Produktinformationen "Enterotoxin Type C-2, Recombinant, Staphylococcus aureus, aa28-266 (EntC2)"
Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death. Source: Recombinant protein corresponding to aa28-266 from Staphylococcus aureus Enterotoxin type C-2, expressed in E. coli. Molecular Weight: ~27.6kD, AA Sequence: ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: SEC2, entC2, Enterotoxin type C-2
Hersteller: United States Biological
Hersteller-Nr: 405917

Eigenschaften

Konjugat: No
MW: 27,6
Format: Purified

Datenbank Information

UniProt ID : P34071 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Enterotoxin Type C-2, Recombinant, Staphylococcus aureus, aa28-266 (EntC2)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen