Enterotoxin Type A, Recombinant, Staphylococcus Aureus, aa25-257, His-Tag (entA)

Enterotoxin Type A, Recombinant, Staphylococcus Aureus, aa25-257, His-Tag (entA)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517892.20 20 µg - -

3 - 19 Werktage*

511,00 €
517892.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The... mehr
Produktinformationen "Enterotoxin Type A, Recombinant, Staphylococcus Aureus, aa25-257, His-Tag (entA)"
Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness is characterized by high fever, hypotension, diarrhea, shock, and in some cases death. Source: Recombinant protein corresponding to aa25-257 of Staphylococcus Aureus Enterotoxin Type A, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~31.1kD, AA Sequence: SEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: SEA, entA, Enterotoxin type A
Hersteller: United States Biological
Hersteller-Nr: 517892

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Staphylococcus Aureus
MW: 31.1 kD
Reinheit: ?90% (SDS-PAGE)

Datenbank Information

UniProt ID : P0A0L2 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Enterotoxin Type A, Recombinant, Staphylococcus Aureus, aa25-257, His-Tag (entA)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen