Endochitinase, Recombinant, Avena Sativa, aa1-200, His-Tag

Endochitinase, Recombinant, Avena Sativa, aa1-200, His-Tag
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405916.20 20 µg - -

3 - 19 Werktage*

455,00 €
405916.100 100 µg - -

3 - 19 Werktage*

713,00 €
 
This protein functions as a defense against chitin-containing fungal... mehr
Produktinformationen "Endochitinase, Recombinant, Avena Sativa, aa1-200, His-Tag"
This protein functions as a defense against chitin-containing fungal pathogens. Source: Recombinant protein corresponding to aa1-200 from avena sativa Endochitinase, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~25.7D, AA Sequence: VSSVISSSLFEKMLLHRGFYTYDAFIAAAKSFPAFATTGSTDVRKREVAAFLAQTSHETTGGWPTAPDGPYELGSTSDYFGRGPIQISYNYNYGAAGKAIGVDLLRNPDLVTSDNTVEFKTALWFWMTPQSPKPSSHDVITGRWSPSSTDKAAGRVPGYGVLTNIIDGGVECGKGQESHVADRIGYYKDNLDCYNQKPFA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: EC=3.2.1.14, Endochitinase
Hersteller: United States Biological
Hersteller-Nr: 405916

Eigenschaften

Konjugat: No
MW: 25,7
Format: Purified

Datenbank Information

UniProt ID : P86181 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Endochitinase, Recombinant, Avena Sativa, aa1-200, His-Tag"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen