DNA Polymerase IV, Recombinant, Colwellia Psychrerythraea, aa1-352, His-tag (dinB)

DNA Polymerase IV, Recombinant, Colwellia Psychrerythraea, aa1-352, His-tag (dinB)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405913.20 20 µg - -

3 - 19 Werktage*

511,00 €
405913.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies... mehr
Produktinformationen "DNA Polymerase IV, Recombinant, Colwellia Psychrerythraea, aa1-352, His-tag (dinB)"
Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by PolIV. Exhibits no 3'-5' exonuclease (proofreading) activity. May be involved in translesional synthesis, in conjunction with the beta clamp from PolIII. Source: Recombinant protein corresponding to aa1-352 from Colwellia Psychrerythraea, DNA Polymerase IV, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.3kD, AA Sequence: MGNQKKIIHIDMDCFYAAIEMRDFPEYQNIPLAVGGDGPRSVLCTSNYQARQFGVRSAMPAIKAKQLCPHLKIVHGRMDVYKETSKNIREIFSRYTDLIEPLSLDEAYLDVTDATMCQGSATLIAERIRADIFNELNLTASAGIAPNKFLAKIASDENKPNGQCVITPDKVANFVEQLSLKKIPGIGPKTFEKLNRHGYVTCADVRQSNIRALQNIVGKFANSLYLKSHGVDNRDLEVSRQRKSLAIETTLAHDISTQDECKLVIDSLYQKLLTRLAPHSNREIIRQGVKLKFTDFNQTTVETQSNECQQALFISLLSKAYSRSNKRGVRLVGLTLGFADSPGESQQLSLSL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Pol IV, CPS_1040, DNA polymerase IV
Hersteller: United States Biological
Hersteller-Nr: 405913

Eigenschaften

Konjugat: No
MW: 43,3
Format: Purified

Datenbank Information

KEGG ID : K02346 | Passende Produkte
UniProt ID : Q487H6 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "DNA Polymerase IV, Recombinant, Colwellia Psychrerythraea, aa1-352, His-tag (dinB)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen