Disintegrin and Metalloproteinase Domain-Containing Protein 12, Recombinant, Mouse, aa206-706, His-T

Disintegrin and Metalloproteinase Domain-Containing Protein 12, Recombinant, Mouse, aa206-706, His-T
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517874.20 20 µg - -

3 - 19 Werktage*

738,00 €
517874.100 100 µg - -

3 - 19 Werktage*

1.536,00 €
 
Involved in skeletal muscle regeneration, specifically at the onset of cell fusion. Also involved... mehr
Produktinformationen "Disintegrin and Metalloproteinase Domain-Containing Protein 12, Recombinant, Mouse, aa206-706, His-T"
Involved in skeletal muscle regeneration, specifically at the onset of cell fusion. Also involved in macrophage-derived giant cells (MGC) and osteoclast formation from mononuclear precursors. Source: Recombinant protein corresponding to aa206-706 of mouse Disintegrin and Metalloproteinase Domain-Containing Protein 12, fused to 10xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~58.4kD, AA Sequence: ETLKMTKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDIDKCSISQDPFTSLHEFLDWRKIKLLPRKSHDNAQLISGVYFQGTTIGMAPIMSMCTAEQSGGVVMDHSDSPLGAAVTLAHELGHNFGMNHDTLERGCSCRMAAEKGGCIMNPSTGFPFPMVFSSCSRKDLEASLEKGMGMCLFNLPEVKQAFGGRKCGNGYVEEGEECDCGEPEECTNRCCNATTCTLKPDAVCAHGQCCEDCQLKPPGTACRGSSNSCDLPEFCTGTAPHCPANVYLHDGHPCQGVDGYCYNGICQTHEQQCVTLWGPGAKPAPGICFERVNSAGDPYGNCGKDSKSAFAKCELRDAKCGKIQCQGGASRPVIGTNAVSIETNIPQQEGGRILCRGTHVYLGDDMPDPGLVLAGTKCAEGKICLNRRCQNISVFGVHKCAMQCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGPIRQADNQG, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Mltna, Adam12, ADAM 12, EC=3.4.24.-, Meltrin-alpha, Disintegrin and metalloproteinase domain-containing protein 12
Hersteller: United States Biological
Hersteller-Nr: 517874

Eigenschaften

Konjugat: No
Wirt: Insect cells
Spezies-Reaktivität: mouse
MW: 58.4 kD
Reinheit: >=90% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Disintegrin and Metalloproteinase Domain-Containing Protein 12, Recombinant, Mouse, aa206-706, His-T"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen