Dedicator of Cytokinesis Protein 8, Recombinant, Mouse, aa561-730, His-Tag (Dock8)

Dedicator of Cytokinesis Protein 8, Recombinant, Mouse, aa561-730, His-Tag (Dock8)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517868.20 20 µg - -

3 - 19 Werktage*

455,00 €
517868.100 100 µg - -

3 - 19 Werktage*

713,00 €
 
Potential guanine nucleotide exchange factor (GEF). GEF proteins activate some small GTPases by... mehr
Produktinformationen "Dedicator of Cytokinesis Protein 8, Recombinant, Mouse, aa561-730, His-Tag (Dock8)"
Potential guanine nucleotide exchange factor (GEF). GEF proteins activate some small GTPases by exchanging bound GDP for free GTP (By similarity). Is involved in NK cell cytotoxicity controlling polarization of microtubule-organizing center (MTOC), and possibly regulating CCDC88B-mediated lytic granule transport to MTOC during cell killing. Source: Partial recombinant protein corresponding to aa561-730 of mouse Dedicator of Cytokinesis Protein 8, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.7kD, AA Sequence: RNLLYVYPQRLNFASKLASARNITIKIQFMCGEDPSNAMPVIFGKSSGPEFLQEVYTAITYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASGESLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSIHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Dock8, Dedicator of cytokinesis protein 8
Hersteller: United States Biological
Hersteller-Nr: 517868

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Mouse
MW: 24.7 kD
Reinheit: ?85% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Dedicator of Cytokinesis Protein 8, Recombinant, Mouse, aa561-730, His-Tag (Dock8)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen