Cyanovirin-N Homolog, Recombinant, Neurospora Crassa, aa1-111, His-Tag (NCU05495)

Cyanovirin-N Homolog, Recombinant, Neurospora Crassa, aa1-111, His-Tag (NCU05495)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517855.20 20 µg - -

3 - 19 Werktage*

455,00 €
517855.200 200 µg - -

3 - 19 Werktage*

1.007,00 €
 
Mannose-binding lectin.||Source:|Recombinant full length protein corresponding to aa1-111 of... mehr
Produktinformationen "Cyanovirin-N Homolog, Recombinant, Neurospora Crassa, aa1-111, His-Tag (NCU05495)"
Mannose-binding lectin. Source: Recombinant full length protein corresponding to aa1-111 of Neurospora Crassa Cyanovirin-N Homolog, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~16.9kD, AA Sequence: MSFHVTAEDARIEVRDNRTILFARLRREDGEWNDASYELDQIIGNNDGHFQWGGQNFTETAEDIRFHPKEGAAEQPILRARLRDCNGEFHDRDVNLTEIVENVNGEFQAKF, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: NCU05495, CV-N homolog, Cyanovirin-N homolog
Hersteller: United States Biological
Hersteller-Nr: 517855

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Neurospora Crassa
MW: 16.9 kD
Reinheit: ~90% (SDS-PAGE)

Datenbank Information

UniProt ID : Q7S6U4 | Passende Produkte
Gene ID : GeneID 3876611 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Cyanovirin-N Homolog, Recombinant, Neurospora Crassa, aa1-111, His-Tag (NCU05495)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen