Cyanovirin-N Homolog, Recombinant, Neurospora Crassa, aa1-111, His-Tag (NCU05495)

Mannose-binding lectin. Source: Recombinant full length protein corresponding to aa1-111 of Neurospora Crassa Cyanovirin-N Homolog, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~16.9kD, AA Sequence: MSFHVTAEDARIEVRDNRTILFARLRREDGEWNDASYELDQIIGNNDGHFQWGGQNFTETAEDIRFHPKEGAAEQPILRARLRDCNGEFHDRDVNLTEIVENVNGEFQAKF, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.