Complement C1q Tumor Necrosis Factor-Related Protein 3, Recombinant, Mouse, aa23-246, His-Tag, Myc-T

Complement C1q Tumor Necrosis Factor-Related Protein 3, Recombinant, Mouse, aa23-246, His-Tag, Myc-T
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517849.20 20 µg - -

3 - 19 Werktage*

511,00 €
517849.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Source:|Recombinant protein corresponding to aa23-246 of mouse Complement C1q Tumor Necrosis... mehr
Produktinformationen "Complement C1q Tumor Necrosis Factor-Related Protein 3, Recombinant, Mouse, aa23-246, His-Tag, Myc-T"
Source:, Recombinant protein corresponding to aa23-246 of mouse Complement C1q Tumor Necrosis Factor-Related Protein 3, fused to 10xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~31.1kD, AA Sequence: QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: CORS26, Cors26, C1qtnf3, Secretory protein CORS26, Collagenous repeat-containing sequence 26 kDa protein, Complement C1q tumor necrosis factor-related protein 3
Hersteller: United States Biological
Hersteller-Nr: 517849

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Mouse
MW: 31.1 kD
Reinheit: ?90% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Complement C1q Tumor Necrosis Factor-Related Protein 3, Recombinant, Mouse, aa23-246, His-Tag, Myc-T"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen