ClfA, Recombinant, Staphylococcus Aureus, aa229-559, His-Tag (Clumping Factor A)

ClfA, Recombinant, Staphylococcus Aureus, aa229-559, His-Tag (Clumping Factor A)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
372785.20 20 µg - -

3 - 19 Werktage*

675,00 €
372785.100 100 µg - -

3 - 19 Werktage*

1.045,00 €
 
Cell surface-associated protein implicated in virulence. Promotes bacterial attachment... mehr
Produktinformationen "ClfA, Recombinant, Staphylococcus Aureus, aa229-559, His-Tag (Clumping Factor A)"
Cell surface-associated protein implicated in virulence. Promotes bacterial attachment exclusively to the gamma-chain of human fibrinogen. Induces formation of bacterial clumps (By similarity). Source: Recombinant protein corresponding to aa229-559 from staphylococcus aureus ClfA, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~38.0kD, AA Sequence: GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: clfA, SACOL0856, Clumping factor A, Fibrinogen receptor A, Fibrinogen-binding protein A
Hersteller: United States Biological
Hersteller-Nr: 372785

Eigenschaften

Konjugat: No
MW: 38
Format: Purified

Datenbank Information

KEGG ID : K14201 | Passende Produkte
UniProt ID : Q5HHM8 | Passende Produkte

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "ClfA, Recombinant, Staphylococcus Aureus, aa229-559, His-Tag (Clumping Factor A)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen