CD8A, Recombinant, Human, aa22-182, His-Tag (T-cell Surface Glycoprotein CD8 alpha Chain)

CD8A, Recombinant, Human, aa22-182, His-Tag (T-cell Surface Glycoprotein CD8 alpha Chain)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
370555.20 20 µg - -

3 - 19 Werktage*

416,00 €
370555.100 100 µg - -

3 - 19 Werktage*

637,00 €
 
Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is... mehr
Produktinformationen "CD8A, Recombinant, Human, aa22-182, His-Tag (T-cell Surface Glycoprotein CD8 alpha Chain)"
Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains. Source: Recombinant protein corresponding to aa22-182 from human CD8A, fused to His-Tag at N-terminal, expressed in yeast. Molecular Weight: ~19.61kD, AA Sequence: SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: MAL, CD8a, CD8A, T-cell surface glycoprotein CD8 alpha chain, T-lymphocyte differentiation antigen T8/Leu-2
Hersteller: United States Biological
Hersteller-Nr: 370555

Eigenschaften

Konjugat: No
MW: 19,61
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "CD8A, Recombinant, Human, aa22-182, His-Tag (T-cell Surface Glycoprotein CD8 alpha Chain)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen