CD63 Antigen, Recombinant, Human, aa103-203, His-Tag (CD63)

CD63 Antigen, Recombinant, Human, aa103-203, His-Tag (CD63)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517841.20 20 µg - -

3 - 19 Werktage*

455,00 €
517841.100 100 µg - -

3 - 19 Werktage*

713,00 €
 
Functions as cell surface receptor for TIMP1 and plays a role in the activation of cellular... mehr
Produktinformationen "CD63 Antigen, Recombinant, Human, aa103-203, His-Tag (CD63)"
Functions as cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli. Source: Partial recombinant protein corresponding to aa103-203 of human CD63 Antigen, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.5kD, AA Sequence: AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: CD63, MLA1, LAMP-3, OMA81H, Tspan-30, CD63 antigen, Granulophysin, Tetraspanin-30, Melanoma-associated antigen ME491, Ocular melanoma-associated antigen, Lysosomal-associated membrane protein 3
Hersteller: United States Biological
Hersteller-Nr: 517841

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Human
MW: 15.5 kD
Reinheit: ?85% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "CD63 Antigen, Recombinant, Human, aa103-203, His-Tag (CD63)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen