Carboxylesterase 1C, Recombinant, Mouse, aa19-550, His-Tag (Ces1c)

Carboxylesterase 1C, Recombinant, Mouse, aa19-550, His-Tag (Ces1c)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
370551.20 20 µg - -

3 - 19 Werktage*

621,00 €
370551.100 100 µg - -

3 - 19 Werktage*

947,00 €
 
Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs.... mehr
Produktinformationen "Carboxylesterase 1C, Recombinant, Mouse, aa19-550, His-Tag (Ces1c)"
Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the Extracellular domain metabolism of lung surfactant. Source: Recombinant protein corresponding to aa19-550 from mouse Ces1c, fused to His-Tag at N-terminal, expressed in yeast. Molecular Weight: ~60.6kD, AA Sequence: HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Es1, Ces1c, PES-N, EC=3.1.1.1, Carboxylesterase 1C, Liver carboxylesterase N, Lung surfactant convertase
Hersteller: United States Biological
Hersteller-Nr: 370551

Eigenschaften

Konjugat: No
MW: 60,6
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Carboxylesterase 1C, Recombinant, Mouse, aa19-550, His-Tag (Ces1c)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen