C Reactive Protein (CRP) Recombinant, Rat

Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P48199, Fragment: His20~Ser230 (Accession No: P48199), Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-H EDMSKQAFVF PGVSATAYVS LEAESKKPLE AFTVCLYAHA DVSRSFSIFS YATKTSFNEI LLFWTRGQGF SIAVGGPEIL FSASEIPEVP THICATWESA TGIVELWLDG KPRVRKSLQK GYIVGTNASI ILGQEQDSYG GGFDANQSLV GDIGDVNMWD FVLSPEQINA VYVGRVFSPN VLNWRALKYE THGDVFIKPQ LWPLTDCCES, Epitope Tag: N-terminal tags: His-tag and T7 tag, Molecular Weight: 27.1kD, Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE., Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -80°C. Aliquots are stable for at least 12 months from date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.