Azurin, Recombinant, Bordetella Bronchiseptica, aa22-150, His-Tag, Myc-Tag (BB3856)

Source:, Recombinant protein corresponding to aa22-150 of Bordetella Bronchiseptica Azurin, fused to 10xHis-Tag and N-terminal at Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~20.8kD, AA Sequence: AECSVDIAGTDQMQFDKKAIEVSKSCKQFTVNLKHTGKLPRNVMGHNWVLTKTADMQAVEKDGIAAGLDNQYLKAGDTRVLAHTKVLGGGESDSVTFDVAKLAAGDDYTFFCSFPGHGALMKGTLKLVD, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.