Azurin, Recombinant, Bordetella Bronchiseptica, aa22-150, His-Tag, Myc-Tag (BB3856)

Azurin, Recombinant, Bordetella Bronchiseptica, aa22-150, His-Tag, Myc-Tag (BB3856)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
517816.20 20 µg - -

3 - 19 Werktage*

511,00 €
517816.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Source:|Recombinant protein corresponding to aa22-150 of Bordetella Bronchiseptica Azurin, fused... mehr
Produktinformationen "Azurin, Recombinant, Bordetella Bronchiseptica, aa22-150, His-Tag, Myc-Tag (BB3856)"
Source:, Recombinant protein corresponding to aa22-150 of Bordetella Bronchiseptica Azurin, fused to 10xHis-Tag and N-terminal at Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~20.8kD, AA Sequence: AECSVDIAGTDQMQFDKKAIEVSKSCKQFTVNLKHTGKLPRNVMGHNWVLTKTADMQAVEKDGIAAGLDNQYLKAGDTRVLAHTKVLGGGESDSVTFDVAKLAAGDDYTFFCSFPGHGALMKGTLKLVD, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Azurin, BB3856
Hersteller: United States Biological
Hersteller-Nr: 517816

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Bordetella Bronchiseptica
MW: 20.8 kD
Reinheit: ?90% (SDS-PAGE)

Datenbank Information

UniProt ID : P0A321 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Azurin, Recombinant, Bordetella Bronchiseptica, aa22-150, His-Tag, Myc-Tag (BB3856)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen