Apoptosis Regulator Bcl-2, Recombinant, Mouse, aa5-205, His-Tag (Bcl2)

Apoptosis Regulator Bcl-2, Recombinant, Mouse, aa5-205, His-Tag (Bcl2)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405872.20 20 µg - -

3 - 19 Werktage*

455,00 €
405872.100 100 µg - -

3 - 19 Werktage*

713,00 €
 
Suppresses apoptosis in a variety of cell systs including factor-dependent lymphohatopoietic and... mehr
Produktinformationen "Apoptosis Regulator Bcl-2, Recombinant, Mouse, aa5-205, His-Tag (Bcl2)"
Suppresses apoptosis in a variety of cell systs including factor-dependent lymphohatopoietic and neural cells. Regulates cell death by controlling the mitochondrial mbrane permeability. Appears to function in a feedback loop syst with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). Source: Recombinant protein corresponding to aa5-205 from mouse Apoptosis regulator Bcl-2, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.7kD, AA Sequence: GRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Bcl2, Bcl-2, Apoptosis regulator Bcl-2
Hersteller: United States Biological
Hersteller-Nr: 405872

Eigenschaften

Konjugat: No
MW: 26,7
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Apoptosis Regulator Bcl-2, Recombinant, Mouse, aa5-205, His-Tag (Bcl2)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen