Apolipoprotein E, Recombinant, Rabbit, aa20-311, His-B2M-tag, Myc-tag (APOE)

Apolipoprotein E, Recombinant, Rabbit, aa20-311, His-B2M-tag, Myc-tag (APOE)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405871.20 20 µg - -

3 - 19 Werktage*

511,00 €
405871.100 100 µg - -

3 - 19 Werktage*

818,00 €
Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a... mehr
Produktinformationen "Apolipoprotein E, Recombinant, Rabbit, aa20-311, His-B2M-tag, Myc-tag (APOE)"
Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues. Source: Recombinant protein corresponding to aa20-311 from rabbit Apolipoprotein E, fused to His-B2M-tag at N-terminal and fused to Myc-tag at C-terminal, expressed in E. coli. Molecular Weight: ~50.6kD, AA Sequence: TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: APOE, Apo-E, Apolipoprotein E
Hersteller: United States Biological
Hersteller-Nr: 405871


Konjugat: No
MW: 50,6
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Apolipoprotein E, Recombinant, Rabbit, aa20-311, His-B2M-tag, Myc-tag (APOE)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen