Apolipoprotein E, Recombinant, Rabbit, aa20-311 (APOE)

Apolipoprotein E, Recombinant, Rabbit, aa20-311 (APOE)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405870.20 20 µg - -

3 - 19 Werktage*

636,00 €
405870.100 100 µg - -

3 - 19 Werktage*

985,00 €
 
Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a... mehr
Produktinformationen "Apolipoprotein E, Recombinant, Rabbit, aa20-311 (APOE)"
Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues. Source: Recombinant protein corresponding to aa19-605 from rabbit APOE, fused to SUMO-Tag at N-terminal, fused to Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~53.6kD, AA Sequence: TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Apoe, Apo-E, Apolipoprotein E
Hersteller: United States Biological
Hersteller-Nr: 405870

Eigenschaften

Konjugat: No
MW: 53,6
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Apolipoprotein E, Recombinant, Rabbit, aa20-311 (APOE)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen