Apoc3, Recombinant, Mouse, aa21-99, His-SUMO-Tag (Apolipoprotein C-III)

Apoc3, Recombinant, Mouse, aa21-99, His-SUMO-Tag (Apolipoprotein C-III)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
370525.20 20 µg - -

3 - 19 Werktage*

455,00 €
370525.100 100 µg - -

3 - 19 Werktage*

713,00 €
 
Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins... mehr
Produktinformationen "Apoc3, Recombinant, Mouse, aa21-99, His-SUMO-Tag (Apolipoprotein C-III)"
Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assbly and secretion, Extracellular domainly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by rnant receptors. Source: Recombinant protein corresponding to aa21-99 from mouse Apoc3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.8kD, AA Sequence: EEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRFLKGYWSKFTDKFTGFWDSNPEDQPTPAIES, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Apoc3, Apo-CIII, ApoC-III, Apolipoprotein C3, Apolipoprotein C-III
Hersteller: United States Biological
Hersteller-Nr: 370525

Eigenschaften

Konjugat: No
MW: 24,8
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Apoc3, Recombinant, Mouse, aa21-99, His-SUMO-Tag (Apolipoprotein C-III)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen