Angiogenin-4, Recombinant, Mouse, aa25-144, His-SUMOSTAR-tag (Ang4)

Angiogenin-4, Recombinant, Mouse, aa25-144, His-SUMOSTAR-tag (Ang4)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405869.20 20 µg - -

3 - 19 Werktage*

455,00 €
405869.100 100 µg - -

3 - 19 Werktage*

711,00 €
 
Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and... mehr
Produktinformationen "Angiogenin-4, Recombinant, Mouse, aa25-144, His-SUMOSTAR-tag (Ang4)"
Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro). Source: Recombinant protein corresponding to aa25-144 from mouse Angiogenin-4, fused to His-SUMOSTAR-tag at N-terminal, expressed in Yeast. Molecular Weight: ~29.9kD, AA Sequence: QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Ang4, EC=3.1.27.-, Angiogenin-4
Hersteller: United States Biological
Hersteller-Nr: 405869

Eigenschaften

Konjugat: No
MW: 29,9
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Angiogenin-4, Recombinant, Mouse, aa25-144, His-SUMOSTAR-tag (Ang4)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen