AmpC, Recombinant, Pseudomonas Aeruginosa, aa27-397, His-SUMO-Tag (Beta-Lactamase)

AmpC, Recombinant, Pseudomonas Aeruginosa, aa27-397, His-SUMO-Tag (Beta-Lactamase)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
370518.20 20 µg - -

3 - 19 Werktage*

511,00 €
370518.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Beta-lactamases (such a penicillinase) are enzymes produced by some bacteria and are responsible... mehr
Produktinformationen "AmpC, Recombinant, Pseudomonas Aeruginosa, aa27-397, His-SUMO-Tag (Beta-Lactamase)"
Beta-lactamases (such a penicillinase) are enzymes produced by some bacteria and are responsible for their resistance to beta-lactam antibiotics like penicillins, cephamycins, and carbapenems (ertapenem). (Cephalosporins are relatively resistant to beta-lactamase.) These antibiotics have a common element in their molecular structure: a four-atom ring known as a beta-lactam. The lactamase enzyme breaks that ring open, deactivating the molecule's antibacterial properties. Source: Recombinant protein corresponding to aa27-397 from Pseudomonas aeruginosa ampC, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~56.65kD, AA Sequence: GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: ampC, PA4110, EC=3.5.2.6, Beta-lactamase, Cephalosporinase
Hersteller: United States Biological
Hersteller-Nr: 370518

Eigenschaften

Konjugat: No
MW: 56,65
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "AmpC, Recombinant, Pseudomonas Aeruginosa, aa27-397, His-SUMO-Tag (Beta-Lactamase)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen