Alpha-synuclein, Recombinant, Rat, aa1-140, GST-Tag (Snca)

May be involved in the regulation of dopamine release and transport. Source: Recombinant protein corresponding to aa 1-140 from rat Alpha-synuclein, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.5kD, AA Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.