Alpha-synuclein, Recombinant, Rat, aa1-140, GST-Tag (Snca)

Alpha-synuclein, Recombinant, Rat, aa1-140, GST-Tag (Snca)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
405868.20 20 µg - -

3 - 19 Werktage*

455,00 €
405868.100 100 µg - -

3 - 19 Werktage*

713,00 €
May be involved in the regulation of dopamine release and transport.||Source:|Recombinant protein... mehr
Produktinformationen "Alpha-synuclein, Recombinant, Rat, aa1-140, GST-Tag (Snca)"
May be involved in the regulation of dopamine release and transport. Source: Recombinant protein corresponding to aa 1-140 from rat Alpha-synuclein, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.5kD, AA Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Snca, Alpha-synuclein
Hersteller: United States Biological
Hersteller-Nr: 405868


Konjugat: No
MW: 41,5
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Alpha-synuclein, Recombinant, Rat, aa1-140, GST-Tag (Snca)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen