ALDH1A2, Recombinant, Human, aa1-518, His-Tag (Retinal Dehydrogenase 2)

ALDH1A2, Recombinant, Human, aa1-518, His-Tag (Retinal Dehydrogenase 2)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
370508.20 20 µg - -

3 - 19 Werktage*

497,00 €
370508.100 100 µg - -

3 - 19 Werktage*

792,00 €
 
Recognizes as substrates free retinal and cellular retinol-binding protein-bound retinal. Does... mehr
Produktinformationen "ALDH1A2, Recombinant, Human, aa1-518, His-Tag (Retinal Dehydrogenase 2)"
Recognizes as substrates free retinal and cellular retinol-binding protein-bound retinal. Does metabolize octanal and decanal but does not metabolize citral, benzaldehyde, acetaldehyde and propanal efficiently, Source: Recombinant protein corresponding to aa1-518 from human ALDH1A2, fused to His-Tag at N-terminal, expressed in Yeast, Molecular Weight: ~58.72kD, AA Sequence: MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: RALDH2, RalDH2, RALDH 2, ALDH1A2, RALDH(II), EC=1.2.1.36, Retinal dehydrogenase 2, Aldehyde dehydrogenase family 1 member A2, Retinaldehyde-specific dehydrogenase type 2
Hersteller: United States Biological
Hersteller-Nr: 370508

Eigenschaften

Konjugat: No
MW: 58,72
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "ALDH1A2, Recombinant, Human, aa1-518, His-Tag (Retinal Dehydrogenase 2)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen