AASDHPPT, Recombinant, Human, aa1-309, His-SUMO-Tag (L-aminoadipate-semialdehyde Dehydrogenase-phosp

AASDHPPT, Recombinant, Human, aa1-309, His-SUMO-Tag (L-aminoadipate-semialdehyde Dehydrogenase-phosp
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
372102.100 100 µg - -

3 - 19 Werktage*

658,00 €
 
Catalyzes the post-translational modification of target proteins by phosphopantetheine. Can... mehr
Produktinformationen "AASDHPPT, Recombinant, Human, aa1-309, His-SUMO-Tag (L-aminoadipate-semialdehyde Dehydrogenase-phosp"
Catalyzes the post-translational modification of target proteins by phosphopantetheine. Can transfer the 4'-phosphopantetheine moiety from coenzyme A to a serine residue of a broad range of acceptors, such as the acyl carrier domain of FASN. Source: Recombinant protein corresponding to aa1-309 from human AASDHPPT, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~51.8kD, AA Sequence: MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: CGI-80, AASDHPPT, AASD-PPT, EC=2.7.8.7, LYS5 ortholog, 4'-phosphopantetheinyl transferase, L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase, Alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase
Hersteller: United States Biological
Hersteller-Nr: 372102

Eigenschaften

Konjugat: No
MW: 51,8
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "AASDHPPT, Recombinant, Human, aa1-309, His-SUMO-Tag (L-aminoadipate-semialdehyde Dehydrogenase-phosp"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen